PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00245g01214.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family CPP
Protein Properties Length: 763aa    MW: 83107.2 Da    PI: 6.338
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00245g01214.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.12.7e-16488527241
                       TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                               ++k+CnCkkskClk+YCeCfaag++C e C+C+dC+Nk  
  Peaxi162Scf00245g01214.1 488 TCKRCNCKKSKCLKLYCECFAAGVYCVEPCSCQDCFNKPM 527
                               689**********************************975 PP

2TCR50.44.5e-16574612139
                       TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                               ++k+gCnCkks ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Peaxi162Scf00245g01214.1 574 RHKRGCNCKKSGCLKKYCECYQGGVGCSINCRCEGCKNA 612
                               589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.9E-17487528IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.124488614IPR005172CRC domain
PfamPF036388.7E-12490525IPR005172CRC domain
SMARTSM011141.5E-17574615IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-11576612IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 763 aa     Download sequence    Send to blast
MGDEQVSLKS EKKEGVVMDT PDRNKNQIST PLSKFEDSPF SNFLNNLSPI MPVKTVQITQ  60
PLNSLSFASV PSVFTSPHLS SLKGSRFLRR QQLSDPSRPE FSSDDGVKVD TDEGISDVVN  120
YSNVKETFGP KISVVEASDM PSSECSKLAS ELARTLNYEC SSPSIIANCV IRSTCLSEVT  180
GRSSVCVPLV QEMSEKGVLS YEVSMEGVSQ TEQNKEASAC DWESLISDAT DVLIFDSPSD  240
PEAFTKERDP GFRSYDFVSN GLRDSQDSSD KVGGDGNELE KHSTQPGKES GLQECLESQS  300
MVLDSSPTNN AMAEDLSKKV DNEMISGLYR GMRRRCLVFE MVGARNKHID ESCGSSDAGS  360
SEQKAGGNPT SEEKQLVKQK PVNESSRCIL PVIGLHLNAL AAASKDGKVV KHESNASGKK  420
LLVAAGSAVN FQPLTIGQES LNKSMPVTFT KRDIVLENAS QTPENTAKED LNQSSKKRRK  480
LEPGEGETCK RCNCKKSKCL KLYCECFAAG VYCVEPCSCQ DCFNKPMHVD TVLATRKQIE  540
SRNPLAFAPK VIRSCDSALS ETRDDSSKTP ASARHKRGCN CKKSGCLKKY CECYQGGVGC  600
SINCRCEGCK NAYGRKDGTD GYVDEEETVT FEKSIVDKCS QKILVQSDTE QNIDSATPAT  660
PLRFGRLPMQ LPFSLKNKPP RSSLLSIGSS SGTYDQGIDR PNSVQPQPLF NKTSDTTQED  720
EIPEVLRVTD SPISTIKSAS PNSKRVSPPH CNIGVSPGRR SSR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1475479KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009770245.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X2
TrEMBLM1D5M10.0M1D5M1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000820980.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24672345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-142TESMIN/TSO1-like CXC 2